Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q6GI26

Expression Region

1-96

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFIQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPATCH3 Antibody - C-terminal region : FITC (ARP70481_P050-FITC)
ARP70481_P050-FITC 100 µL

GPATCH3 Antibody - C-terminal region : FITC (ARP70481_P050-FITC)

Sign In for Pricing
View Details
Mouse Monoclonal Influenza B Virus Antibody (InB18) [Alexa Fluor 700]
NB100-73163AF700 0.2 mL

Mouse Monoclonal Influenza B Virus Antibody (InB18) [Alexa Fluor 700]

Sign In for Pricing
View Details
COL17A1, ID (COL17A1, BP180, BPAG2, Collagen alpha-1(XVII) chain, 180kD bullous pemphigoid antigen 2, Bullous pemphigoid antigen 2, 120kD linear IgA disease antigen, 120kD linear IgA dermatosis antigen, Linear IgA disease antigen 1, 97kD linear IgA diseas
MBS6287583-01 0.2 mL

COL17A1, ID (COL17A1, BP180, BPAG2, Collagen alpha-1(XVII) chain, 180kD bullous pemphigoid antigen 2, Bullous pemphigoid antigen 2, 120kD linear IgA disease antigen, 120kD linear IgA dermatosis antigen, Linear IgA disease antigen 1, 97kD linear IgA diseas

Sign In for Pricing
View Details
COL17A1, ID (COL17A1, BP180, BPAG2, Collagen alpha-1(XVII) chain, 180kD bullous pemphigoid antigen 2, Bullous pemphigoid antigen 2, 120kD linear IgA disease antigen, 120kD linear IgA dermatosis antigen, Linear IgA disease antigen 1, 97kD linear IgA diseas
MBS6287583-02 5x 0.2 mL

COL17A1, ID (COL17A1, BP180, BPAG2, Collagen alpha-1(XVII) chain, 180kD bullous pemphigoid antigen 2, Bullous pemphigoid antigen 2, 120kD linear IgA disease antigen, 120kD linear IgA dermatosis antigen, Linear IgA disease antigen 1, 97kD linear IgA diseas

Sign In for Pricing
View Details
Mouse Monoclonal FSH R Antibody (FSHR/1400) [FITC]
NBP2-54329F 100 µL

Mouse Monoclonal FSH R Antibody (FSHR/1400) [FITC]

Sign In for Pricing
View Details
SFRS2, ID (Splicing Factor, Arginine/Serine-Rich 2, Splicing Factor SC35, SC-35, Splicing Component, 35kD, Protein PR264) (APC)
MBS6500536-01 0.2 mL

SFRS2, ID (Splicing Factor, Arginine/Serine-Rich 2, Splicing Factor SC35, SC-35, Splicing Component, 35kD, Protein PR264) (APC)

Sign In for Pricing
View Details