Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q6GI26

Expression Region

1-96

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFIQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Karyopherin Alpha 3 Blocking Peptide
33R-1141 100 ug

Karyopherin Alpha 3 Blocking Peptide

Sign In for Pricing
View Details
ING3 antibody
70R-2097 50 ug

ING3 antibody

Sign In for Pricing
View Details
Vacuolar protein sorting-associated protein 13C (VPS13C) Human ELISA Kit
I1822 96 Tests

Vacuolar protein sorting-associated protein 13C (VPS13C) Human ELISA Kit

Sign In for Pricing
View Details
Human FETUB (Fetuin B) ELISA Kit
EH24869 96 Tests

Human FETUB (Fetuin B) ELISA Kit

Sign In for Pricing
View Details
AKAP1 Antibody - C-terminal region : HRP (ARP36334_P050-HRP)
ARP36334_P050-HRP 100 µL

AKAP1 Antibody - C-terminal region : HRP (ARP36334_P050-HRP)

Sign In for Pricing
View Details
PCDNA3.1-GMEB1 (mouse) -1-FLAG (3Synonymous mutation)
BZ32482 1 Vial

PCDNA3.1-GMEB1 (mouse) -1-FLAG (3Synonymous mutation)

Sign In for Pricing
View Details