Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q8CPP9

Expression Region

1-96

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEG KDGRLQSFKVIFAIIITLVTVIGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARS2 (B-11) Alexa Fluor® 647
sc-376716 AF647 200 µg/mL

ARS2 (B-11) Alexa Fluor® 647

Sign In for Pricing
View Details
MMD siRNA (Rat)
MBS829719-01 15 nmol

MMD siRNA (Rat)

Sign In for Pricing
View Details
MMD siRNA (Rat)
MBS829719-02 30 nmol

MMD siRNA (Rat)

Sign In for Pricing
View Details
MMD siRNA (Rat)
MBS829719-03 5x 30 nmol

MMD siRNA (Rat)

Sign In for Pricing
View Details
Annexin A1 Antibody
V7283IHC-7ML 7 mL

Annexin A1 Antibody

Sign In for Pricing
View Details
Recombinant Human KANK2, His-tagged
KANK2-219H 25 µg

Recombinant Human KANK2, His-tagged

Sign In for Pricing
View Details