Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD)
This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.
Product Specifications
Product Name Alternative
Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV
UniProt
Q8CPP9
Expression Region
1-96
Origin
Staphylococcus epidermidis (strain ATCC 12228)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEG KDGRLQSFKVIFAIIITLVTVIGTYWVMQGGHSSHL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039940-ML405 100 µL
PHEX, CT (PHEX, PEX, Phosphate-regulating neutral endopeptidase, Metalloendopeptidase homolog PEX, Vitamin D-resistant hypophosphatemic rickets protein, X-linked hypophosphatemia protein) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
12897111 3x 1.0 µg
AXIN1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
