Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q99V39

Expression Region

1-96

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_001005909) Human Over-expression Lysate
LC425158 20 µg

Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_001005909) Human Over-expression Lysate

Sign In for Pricing
View Details
Gamithromycin-d4 (Major)
TRC-G195002-1MG 1 mg

Gamithromycin-d4 (Major)

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), CF488A conjugate, 0.1mg/mL
BNC882030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS647834 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Human IL-4 Antibody Pair Set
E-KAB-0402 50 µL & 100 µg

Human IL-4 Antibody Pair Set

Sign In for Pricing
View Details
D10Wsu102e (NM_026579) Mouse Tagged ORF Clone
MG201713 10 µg

D10Wsu102e (NM_026579) Mouse Tagged ORF Clone

Sign In for Pricing
View Details