Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN)

This Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q9HPH5

Expression Region

1-96

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRWLAAGGILLGALVVFSFVSAGAWGGADGVAGDTITTINPSYEPWFQSLWTPPSGEIE SLLFSIQAAVGGIIIGYYLGRDRPRGQSQDMGSDLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish GNB1/1b Antibody Picoband® Fluoro488 Conjugated
AZQ6PH57-Fluoro488 100 µg/Vial

Anti-Zebrafish GNB1/1b Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CCK-33 (Human)
PCK-4201-S 0.1 mg

CCK-33 (Human)

Sign In for Pricing
View Details
Recombinant HIV-1 Protease Protein, Untagged, E.coli-10ug
QP12260-10ug 10ug

Recombinant HIV-1 Protease Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
Quick Step Human Carboxylesterase 1 (CES1) elisa Kit
QS3348Hu-01 48 Tests

Quick Step Human Carboxylesterase 1 (CES1) elisa Kit

Sign In for Pricing
View Details
Quick Step Human Carboxylesterase 1 (CES1) elisa Kit
QS3348Hu-02 96 Tests

Quick Step Human Carboxylesterase 1 (CES1) elisa Kit

Sign In for Pricing
View Details
AKR1C3 Recombinant Antibody, Cy7 Conjugated
bsm-62035R-Cy7-TR 20 µL

AKR1C3 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details