Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN)

This Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q9HPH5

Expression Region

1-96

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRWLAAGGILLGALVVFSFVSAGAWGGADGVAGDTITTINPSYEPWFQSLWTPPSGEIE SLLFSIQAAVGGIIIGYYLGRDRPRGQSQDMGSDLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 6-keto-prostaglandin F1a (6-keto-PGF1a) ELISA Kit
YP-W12475-01 48 Tests

Human 6-keto-prostaglandin F1a (6-keto-PGF1a) ELISA Kit

Sign In for Pricing
View Details
Human 6-keto-prostaglandin F1a (6-keto-PGF1a) ELISA Kit
YP-W12475-02 96 Tests

Human 6-keto-prostaglandin F1a (6-keto-PGF1a) ELISA Kit

Sign In for Pricing
View Details
IGF2BP2, CT (IGF2BP2, IMP2, VICKZ2, Insulin-like growth factor 2 mRNA-binding protein 2, Hepatocellular carcinoma autoantigen p62, IGF-II mRNA-binding protein 2, VICKZ family member 2) (MaxLight 405) discontinued
036911-ML405 100 µL

IGF2BP2, CT (IGF2BP2, IMP2, VICKZ2, Insulin-like growth factor 2 mRNA-binding protein 2, Hepatocellular carcinoma autoantigen p62, IGF-II mRNA-binding protein 2, VICKZ family member 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rno-miR-6216 miRNA Mimic
CMR0685-01 5 nmol

Rno-miR-6216 miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-6216 miRNA Mimic
CMR0685-02 10 nmol

Rno-miR-6216 miRNA Mimic

Sign In for Pricing
View Details
Chicken Olfactory receptor 51F2 (OR51F2) ELISA Kit
GTR10323245 96 Well

Chicken Olfactory receptor 51F2 (OR51F2) ELISA Kit

Sign In for Pricing
View Details