Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN)
This Recombinant Halobacterium salinarum Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-96.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN
UniProt
Q9HPH5
Expression Region
1-96
Origin
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNRWLAAGGILLGALVVFSFVSAGAWGGADGVAGDTITTINPSYEPWFQSLWTPPSGEIE SLLFSIQAAVGGIIIGYYLGRDRPRGQSQDMGSDLP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6355232-01 0.2 mL
TGIF1, ID (A160) (TGIF1, TGIF, Homeobox protein TGIF1, 5'-TG-3'-interacting factor 1) (HRP)
Sign In for Pricing
View Details MBS6355232-02 5x 0.2 mL
TGIF1, ID (A160) (TGIF1, TGIF, Homeobox protein TGIF1, 5'-TG-3'-interacting factor 1) (HRP)
Sign In for Pricing
View Details 