Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Coiled-coil domain-containing protein 56 (ccdc56)

This Recombinant Danio rerio Coiled-coil domain-containing protein 56 (ccdc56) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

A8KB87

Expression Region

1-96

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSQGEPKPEAQFAKRIDPTKEALTKEQLQFIRQVEMAQWKKKTDKLRGRNVATGLAIGA VVLGIYGYTFYSVSQEKIMDEIDEEAKVRVPKTGAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA1 Antibody
KC-583-01 50 μL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-583-02 100 µL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-583-03 1 mL

IFNA1 Antibody

Sign In for Pricing
View Details
Benzo[b]thien-3-ylboronic Acid
TRC-B206890-5G 5 g

Benzo[b]thien-3-ylboronic Acid

Sign In for Pricing
View Details
ITPK1 (NM_001142593) Human Over-expression Lysate
LY428194 100 µg

ITPK1 (NM_001142593) Human Over-expression Lysate

Sign In for Pricing
View Details
Monkey Apolipoprotein A1 (APOA1) ELISA Kit
RD-APOA1-Si-01 96 Tests

Monkey Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details