Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

P60692

Expression Region

1-97

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BMT2 activation kit by CRISPRa
GA115895 1 Kit

Human BMT2 activation kit by CRISPRa

Sign In for Pricing
View Details
(-)-Epicatechin-4'-O-glucuronide
TRC-E582340-1MG 1 mg

(-)-Epicatechin-4'-O-glucuronide

Sign In for Pricing
View Details
C5orf67 (NM_001287053) Human Tagged ORF Clone
RG235845 10 µg

C5orf67 (NM_001287053) Human Tagged ORF Clone

Sign In for Pricing
View Details
TMEM161A antibody
FNab08755 100 µg

TMEM161A antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB533268 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
ZBTB3 Rabbit Polyclonal Antibody
TA366760 100 µL

ZBTB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details