Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

P60692

Expression Region

1-97

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF568 conjugate, 0.1mg/mL
BNC682309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Portable Trace Drug Detector DT BDRD-201
BDRD-201 1 Unit

Portable Trace Drug Detector DT BDRD-201

Sign In for Pricing
View Details
HB EGF (HBEGF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A4]
TA812463BM 100 µL

HB EGF (HBEGF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A4]

Sign In for Pricing
View Details
1-Pyrenedecanoic Acid
TRC-P989318-10MG 10 mg

1-Pyrenedecanoic Acid

Sign In for Pricing
View Details
SMN1 Rabbit Polyclonal Antibody
TA381781 100 µL

SMN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Boc-2-pyrrolidineacetic Acid
TRC-B665960-500MG 500 mg

1-Boc-2-pyrrolidineacetic Acid

Sign In for Pricing
View Details