Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P08382

Expression Region

1-97

Origin

Influenza A virus (strain A/Mallard/New York/6750/1978 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB8 Rabbit Polyclonal Antibody
TA361128 100 µL

DNAJB8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-100 1x 100 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (C28/76), CF594 conjugate, 0.1mg/mL
BNC940076-500 1x 500 µL

CD28 (C28/76), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pivmecillinam-D9
TRC-P190442-5MG 5 mg

Pivmecillinam-D9

Sign In for Pricing
View Details
Pyruvic Acid-13C2
TRC-P998907-1MG 1 mg

Pyruvic Acid-13C2

Sign In for Pricing
View Details
Strept. Avidin Colloidal Gold, 1mL 10nm
GA-02-10 1 mL

Strept. Avidin Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details