Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P08382

Expression Region

1-97

Origin

Influenza A virus (strain A/Mallard/New York/6750/1978 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), 0.2mg/mL
BNUB2063-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), 0.2mg/mL

Sign In for Pricing
View Details
EAAC1 Antibody: ATTO 488
SMC-406D-A488 100 µg

EAAC1 Antibody: ATTO 488

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RD-17-OHP-Ge-01 96 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RD-17-OHP-Ge-02 48 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details
LRP8 Rabbit Monoclonal Antibody [Clone ID: 23GB2520]
TA424932 100 µL

LRP8 Rabbit Monoclonal Antibody [Clone ID: 23GB2520]

Sign In for Pricing
View Details
PALM2AKAP2 Antibody
KC-36613-01 50 μL

PALM2AKAP2 Antibody

Sign In for Pricing
View Details