Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P08382

Expression Region

1-97

Origin

Influenza A virus (strain A/Mallard/New York/6750/1978 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzoic-13C Acid
TRC-B203955-250MG 250 mg

Benzoic-13C Acid

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Vmn1r226 Mouse Gene Knockout Kit (CRISPR)
KN519021 1 Kit

Vmn1r226 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]
ET1705-55 100 µL

Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]

Sign In for Pricing
View Details