Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P05778

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Weybridge H7N7) (Influenza A virus (strain A/FPV/Weybridge H7N7) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECSCSDSSDPLVIAASIIGILHFILWILDRLFFKCIYRRLKYGLK RGPSTEGVPKSMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD430 amine
70023-AAT 1 mg

XFD430 amine

Sign In for Pricing
View Details
SCN3B Human qPCR Primer Pair (NM_018400)
HP226304 200 Reactions

SCN3B Human qPCR Primer Pair (NM_018400)

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) Rabbit Polyclonal Antibody
TA392894 100 µL

Phospholipase C gamma 1 (PLCG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P2RY5 (LPAR6) Human Gene Knockout Kit (CRISPR)
KN207345BN 1 Kit

P2RY5 (LPAR6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-ADCA Pivalamide
TRC-A235000-50MG 50 mg

7-ADCA Pivalamide

Sign In for Pricing
View Details
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA373213 100 µL

FACL4 (ACSL4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details