Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P05780

Expression Region

1-97

Origin

Influenza A virus (strain A/Wilson-Smith/1933 H1N1) (Influenza A virus (strain A/WS/1933 H1N1) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVIAANIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRKEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sutezolid 25mg
A12638-25 25 mg

Sutezolid 25mg

Sign In for Pricing
View Details
V1re18 AAV siRNA Pooled Vector
49412166 1.0 µg

V1re18 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Duck Betacellulin ELISA Kit
MBS089288 Inquire

Duck Betacellulin ELISA Kit

Sign In for Pricing
View Details
Ethyl 4-formyl-1,3-thiazole-5-carboxylate
UWA70432-01 50 mg

Ethyl 4-formyl-1,3-thiazole-5-carboxylate

Sign In for Pricing
View Details
Ethyl 4-formyl-1,3-thiazole-5-carboxylate
UWA70432-02 0.5 g

Ethyl 4-formyl-1,3-thiazole-5-carboxylate

Sign In for Pricing
View Details
Anti-AQP12 Rabbit pAb
GB113364-50 50 μL

Anti-AQP12 Rabbit pAb

Sign In for Pricing
View Details