Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P03492

Expression Region

1-97

Origin

Influenza A virus (strain A/Fowl plague virus/Rostock/8/1934 H7N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCNDSSDPLIIAASIIGILHLILWILNRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Hexachloroplatinate(IV) Hexahydrate
TRC-S077210-2.5G 2.5 g

Sodium Hexachloroplatinate(IV) Hexahydrate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), Biotin conjugate, 0.1mg/mL
BNCB2175-500 1x 500 µL

Cytokeratin 8 (KRT8) (rB22.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HRPT2 (CDC73) (NM_024529) Human Over-expression Lysate
LY402998 100 µg

HRPT2 (CDC73) (NM_024529) Human Over-expression Lysate

Sign In for Pricing
View Details
LYPLA1 Antibody
8C14279-AAT 50 µg

LYPLA1 Antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Spleen
CD564440 5 µg

Tissue Genomic DNA, Spleen

Sign In for Pricing
View Details
Her2 (ERBB2) Rabbit Polyclonal Antibody
TA375954 100 µL

Her2 (ERBB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details