Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P03492

Expression Region

1-97

Origin

Influenza A virus (strain A/Fowl plague virus/Rostock/8/1934 H7N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCNDSSDPLIIAASIIGILHLILWILNRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXC1 (NM_001453) Human Over-expression Lysate
LC400565 20 µg

FOXC1 (NM_001453) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Heptyl Chloroformate
TRC-H282990-2.5G 2.5 g

2-Heptyl Chloroformate

Sign In for Pricing
View Details
TIE1 (NM_005424) Human Recombinant Protein
TP720418L 500 µg

TIE1 (NM_005424) Human Recombinant Protein

Sign In for Pricing
View Details
MVP (N-term) Rabbit Polyclonal Antibody
AP15180PU-N 400 µL

MVP (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD10 Antibody[CB-CALLA]
E-AB-F1078G-01 20 Tests

PE/Cyanine5 Anti-Human CD10 Antibody[CB-CALLA]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD10 Antibody[CB-CALLA]
E-AB-F1078G-02 100 Tests

PE/Cyanine5 Anti-Human CD10 Antibody[CB-CALLA]

Sign In for Pricing
View Details