Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 167 (CCDC167)

This Recombinant Bovine Coiled-coil domain-containing protein 167 (CCDC167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

A1A4P9

Expression Region

1-97

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVALEIDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKA SNYEKELKLLRQENRKNMLLSVAIFLLLTVIYAYWAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF550 siRNA (Human)
orb1852294-01 15 nmol

ZNF550 siRNA (Human)

Sign In for Pricing
View Details
ZNF550 siRNA (Human)
orb1852294-02 30 nmol

ZNF550 siRNA (Human)

Sign In for Pricing
View Details
Kctd5 (NM_027008) Mouse Tagged Lenti ORF Clone
MR202827L3 10 µg

Kctd5 (NM_027008) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZDHHC18 antibody
70R-7069 100 µL

ZDHHC18 antibody

Sign In for Pricing
View Details
CLCN4 (NM_001830) Human Tagged ORF Clone
RC217040 10 µg

CLCN4 (NM_001830) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTBP2 Mouse Monoclonal Antibody (Fluoro594)
orb3084282 100 µg

PTBP2 Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details