Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 167 (CCDC167)

This Recombinant Bovine Coiled-coil domain-containing protein 167 (CCDC167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

A1A4P9

Expression Region

1-97

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVALEIDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKA SNYEKELKLLRQENRKNMLLSVAIFLLLTVIYAYWAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANO1 Antibody - C-terminal region : Biotin (ARP72448_P050-Biotin)
ARP72448_P050-Biotin 100 µL

ANO1 Antibody - C-terminal region : Biotin (ARP72448_P050-Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal USF2 Antibody [FITC]
NBP1-92647F 0.1 mL

Rabbit Polyclonal USF2 Antibody [FITC]

Sign In for Pricing
View Details
Cyanine 7, SE
445197-01 1 mg

Cyanine 7, SE

Sign In for Pricing
View Details
Cyanine 7, SE
445197-02 5 mg

Cyanine 7, SE

Sign In for Pricing
View Details
Slc10a4 Rat shRNA Lentiviral Particle (Locus ID 305309)
TL701083V 500 µL Each

Slc10a4 Rat shRNA Lentiviral Particle (Locus ID 305309)

Sign In for Pricing
View Details
Test Tube Light Wall 15ml Qfit
QMF24150 5 / PCK

Test Tube Light Wall 15ml Qfit

Sign In for Pricing
View Details