Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A3DRP1

Expression Region

1-97

Origin

Influenza A virus (strain A/USA:Memphis/10/1996 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFFKCIYRIFKHGLK RGPSTEGVPESMREEYREEQQNAVDADEGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eNOS (NOS3) Rabbit Polyclonal Antibody
AP20724PU-N 100 µg

eNOS (NOS3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (rIGB/1842), CF405S conjugate, 0.1mg/mL
BNC043604-500 1x 500 µL

CD79b (B-Cell Marker) (rIGB/1842), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pre and Post Vacuum Class B Autoclave BAPV-201
BAPV-201 1 Unit

Pre and Post Vacuum Class B Autoclave BAPV-201

Sign In for Pricing
View Details
(-)-Epicatechin-3'-O-glucuronide
TRC-E582335-5MG 5 mg

(-)-Epicatechin-3'-O-glucuronide

Sign In for Pricing
View Details
ZNF763 Rabbit Polyclonal Antibody
TA383607 100 µL

ZNF763 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUPT16H Human Gene Knockout Kit (CRISPR)
KN418797 1 Kit

SUPT16H Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details