Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A3DRP1

Expression Region

1-97

Origin

Influenza A virus (strain A/USA:Memphis/10/1996 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFFKCIYRIFKHGLK RGPSTEGVPESMREEYREEQQNAVDADEGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Icatibant (1-5) Trifluoroacetic Acid Salt
TRC-I163755-5MG 5 mg

Icatibant (1-5) Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Cyanidin 3-O-Beta-D-Galactopyranoside Chloride
TRC-C958000-1MG 1 mg

Cyanidin 3-O-Beta-D-Galactopyranoside Chloride

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF405S conjugate, 0.1mg/mL
BNC042616-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APOC3 peptide Antibody
KC-1404-01 50 μL

APOC3 peptide Antibody

Sign In for Pricing
View Details
APOC3 peptide Antibody
KC-1404-02 100 µL

APOC3 peptide Antibody

Sign In for Pricing
View Details
APOC3 peptide Antibody
KC-1404-03 1 mL

APOC3 peptide Antibody

Sign In for Pricing
View Details