Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4GCJ8

Expression Region

1-97

Origin

Influenza A virus (strain A/India/6263/1980 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYREEQQNAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transthyretin (Prealbumin) (CPTC-TTR-1), CF488A conjugate, 0.1mg/mL
BNC882249-500 1x 500 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant HLA-C Antibody
RC-4607-01 50 μL

Recombinant HLA-C Antibody

Sign In for Pricing
View Details
Recombinant HLA-C Antibody
RC-4607-02 100 µL

Recombinant HLA-C Antibody

Sign In for Pricing
View Details
Recombinant HLA-C Antibody
RC-4607-03 1 mL

Recombinant HLA-C Antibody

Sign In for Pricing
View Details
NSUN2 (NM_017755) Human Recombinant Protein
TP314459L 1 mg

NSUN2 (NM_017755) Human Recombinant Protein

Sign In for Pricing
View Details
Seryl tRNA synthetase (SARS) (NM_006513) Human Recombinant Protein
TP303665 20 µg

Seryl tRNA synthetase (SARS) (NM_006513) Human Recombinant Protein

Sign In for Pricing
View Details