Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4GCJ8

Expression Region

1-97

Origin

Influenza A virus (strain A/India/6263/1980 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYREEQQNAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]
TA813263AM 100 µL

CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]

Sign In for Pricing
View Details
Anti Human BORIS Polyclonal
Y055159 100 µL

Anti Human BORIS Polyclonal

Sign In for Pricing
View Details
Ammonium Dichromate
TRC-A633980-5G 5 g

Ammonium Dichromate

Sign In for Pricing
View Details
MAP1LC3A (NM_181509) Human Recombinant Protein
TP761490 50 µg

MAP1LC3A (NM_181509) Human Recombinant Protein

Sign In for Pricing
View Details
Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI5B1]
CF813768 100 µg

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI5B1]

Sign In for Pricing
View Details
RS1 (NM_000330) Human Over-expression Lysate
LC424787 20 µg

RS1 (NM_000330) Human Over-expression Lysate

Sign In for Pricing
View Details