Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4GCJ8

Expression Region

1-97

Origin

Influenza A virus (strain A/India/6263/1980 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYREEQQNAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CFH (Complement Factor H) ELISA Kit
E-EL-H6057-01 24 Tests

Human CFH (Complement Factor H) ELISA Kit

Sign In for Pricing
View Details
Human CFH (Complement Factor H) ELISA Kit
E-EL-H6057-02 48 Tests

Human CFH (Complement Factor H) ELISA Kit

Sign In for Pricing
View Details
Human CFH (Complement Factor H) ELISA Kit
E-EL-H6057-03 96 Tests

Human CFH (Complement Factor H) ELISA Kit

Sign In for Pricing
View Details
ABCA10 Rabbit Polyclonal Antibody
TA371195 100 µL

ABCA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF161 (VEZF1) Human Gene Knockout Kit (CRISPR)
KN422182 1 Kit

ZNF161 (VEZF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DABCYL C2 maleimide
2008-AAT 25 mg

DABCYL C2 maleimide

Sign In for Pricing
View Details