Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4K144

Expression Region

1-97

Origin

Influenza A virus (strain A/Malaysia:Malaya/302/1954 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLIIAASVVGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRC Human Knockdown Lysate
LY300494 100 µg

SRC Human Knockdown Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG3 HP6047,  5nm
GM-204-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG3 HP6047, 5nm

Sign In for Pricing
View Details
ELP3 (NM_018091) Human Over-expression Lysate
LY402648 100 µg

ELP3 (NM_018091) Human Over-expression Lysate

Sign In for Pricing
View Details
IL17F CytoSection
TS409973P5 25 Slides

IL17F CytoSection

Sign In for Pricing
View Details
SPATA4 (NM_144644) Human Recombinant Protein
TP760131 50 µg

SPATA4 (NM_144644) Human Recombinant Protein

Sign In for Pricing
View Details
GATA2 + GATA3 Recombinant Rabbit Monoclonal Antibody [JE04-46]
HA722713 100 µL

GATA2 + GATA3 Recombinant Rabbit Monoclonal Antibody [JE04-46]

Sign In for Pricing
View Details