Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4K144

Expression Region

1-97

Origin

Influenza A virus (strain A/Malaysia:Malaya/302/1954 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLIIAASVVGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Abca2 activation kit by CRISPRa
GA200006 1 Kit

Mouse Abca2 activation kit by CRISPRa

Sign In for Pricing
View Details
DEP1 (PTPRJ) (NM_002843) Human Recombinant Protein
TP322707 20 µg

DEP1 (PTPRJ) (NM_002843) Human Recombinant Protein

Sign In for Pricing
View Details
DYNLT1 (NM_006519) Human Recombinant Protein
TP318331M 100 µg

DYNLT1 (NM_006519) Human Recombinant Protein

Sign In for Pricing
View Details
Tris, 1kg
PR0612-1kg 1 Kg

Tris, 1kg

Sign In for Pricing
View Details
Calnexin-NT Antibody: Biotin
SPC-127B-BI 200 µL

Calnexin-NT Antibody: Biotin

Sign In for Pricing
View Details
KCNN2 Polyclonal Antibody
E-AB-18171-01 20 µL

KCNN2 Polyclonal Antibody

Sign In for Pricing
View Details