Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A4U7A7

Expression Region

1-97

Origin

Influenza A virus (strain A/USA:Albany/12/1951 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRC1 CRISPR Activation Plasmid (h2)
sc-404435-ACT-2 20 µg

UQCRC1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
COL3A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16575111 3x 1.0 µg

COL3A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Methyl 3-hydroxy-5-isopropoxybenzoate
OR1062007-01 100 mg

Methyl 3-hydroxy-5-isopropoxybenzoate

Sign In for Pricing
View Details
Methyl 3-hydroxy-5-isopropoxybenzoate
OR1062007-02 250 mg

Methyl 3-hydroxy-5-isopropoxybenzoate

Sign In for Pricing
View Details
VIPR1 Peptide - C-terminal region
orb1998893 100 µg

VIPR1 Peptide - C-terminal region

Sign In for Pricing
View Details
DAP kinase 3 Antibody (YA3319, Rabbit)
HY-P83574-01 10 µL

DAP kinase 3 Antibody (YA3319, Rabbit)

Sign In for Pricing
View Details