Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN)

This Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A6VH67

Expression Region

1-97

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFKHVLMILGVIILTLAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE PPSGEIESLLFALQAAIGALIIGYFFGYNKAKYDDQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A (Acetyl Lys120) rabbit pAb
E28PK0134 100 µL

Histone H2A (Acetyl Lys120) rabbit pAb

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details
Caps2 Mouse qPCR Primer Pair (NM_178278)
MP201602 200 Reactions

Caps2 Mouse qPCR Primer Pair (NM_178278)

Sign In for Pricing
View Details
Human ACP2 (Acid Phosphatase 2, Lysosomal) ELISA Kit
EH25123 96 Tests

Human ACP2 (Acid Phosphatase 2, Lysosomal) ELISA Kit

Sign In for Pricing
View Details