Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A6QFF7

Expression Region

1-97

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin-1 (CALP), CF405S conjugate, 0.1mg/mL
BNC040831-100 1x 100 µL

Calponin-1 (CALP), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mrps21 (NM_078479) Mouse Tagged ORF Clone
MG200200 10 µg

Mrps21 (NM_078479) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL
BNC880532-500 1x 500 µL

Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC-iFluor® 710 Tandem
2631-AAT 1 mg

APC-iFluor® 710 Tandem

Sign In for Pricing
View Details
(3Alpha,17Beta)-Diacetate Estr-5(10)-ene-3,17-diol
TRC-D144135-50MG 50 mg

(3Alpha,17Beta)-Diacetate Estr-5(10)-ene-3,17-diol

Sign In for Pricing
View Details
TMA-DPH *CAS#: 115534-33-3*
21492-AAT 5 mg

TMA-DPH *CAS#: 115534-33-3*

Sign In for Pricing
View Details