Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A6QFF7

Expression Region

1-97

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Over-expression Lysate
LC400202 20 µg

Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Over-expression Lysate

Sign In for Pricing
View Details
Anthraquinone-2,1-benzacridone
TRC-A242750-100MG 100 mg

Anthraquinone-2,1-benzacridone

Sign In for Pricing
View Details
Cytokeratin 14 Recombinant Mouse Monoclonal Antibody [A2C11-R]
HA601259 100 µL

Cytokeratin 14 Recombinant Mouse Monoclonal Antibody [A2C11-R]

Sign In for Pricing
View Details
Human High Density Lipoprotein (HDL) ELISA Kit
RDR-HDL-Hu-01 96 Tests

Human High Density Lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Human High Density Lipoprotein (HDL) ELISA Kit
RDR-HDL-Hu-02 48 Tests

Human High Density Lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ERK3/MAPK12 Protein
PKSH030317 50 µg

Recombinant Human ERK3/MAPK12 Protein

Sign In for Pricing
View Details