Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A6QFF7

Expression Region

1-97

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arhgap23 activation kit by CRISPRa
GA206321 1 Kit

Mouse Arhgap23 activation kit by CRISPRa

Sign In for Pricing
View Details
DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]
CF807746 100 µg

DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]

Sign In for Pricing
View Details
Sodium Acetate-1,2-13C2
TRC-S610971-250MG 250 mg

Sodium Acetate-1,2-13C2

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF568 conjugate, 0.1mg/mL
BNC682111-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac 2-Chloro Nicotine
TRC-C380565-5MG 5 mg

rac 2-Chloro Nicotine

Sign In for Pricing
View Details