Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A8C8W4

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Wisconsin/1/1967 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWECRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQNAVDVDDGHFVNIVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP7 siRNA (Rat)
CRR5856-01 15 nmol

AKAP7 siRNA (Rat)

Sign In for Pricing
View Details
AKAP7 siRNA (Rat)
CRR5856-02 30 nmol

AKAP7 siRNA (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal DYRK3 Antibody
NBP3-12695-100ul 100 µL

Rabbit Polyclonal DYRK3 Antibody

Sign In for Pricing
View Details
Human Lupus Lung Tissue Lysate
IHULGLUPPTL100UG 1 Each

Human Lupus Lung Tissue Lysate

Sign In for Pricing
View Details
Rac-Taletrectinib-d4 Adipate
TRC-R939931-100MG 100 mg

Rac-Taletrectinib-d4 Adipate

Sign In for Pricing
View Details
Lentiviral human DENND11 sgRNA gene knockout kit - Lentiviral human DENND11 sgRNA gene knockout kit (plasmid)
GTR15354730 1 Vial

Lentiviral human DENND11 sgRNA gene knockout kit - Lentiviral human DENND11 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details