Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A8C8W4

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Wisconsin/1/1967 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWECRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQNAVDVDDGHFVNIVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dclre1c shRNA (UAS) - Lentiviral mouse Dclre1c shRNA (UAS, iRFP) plasmid
GTR15286672 1 Vial

Lentiviral mouse Dclre1c shRNA (UAS) - Lentiviral mouse Dclre1c shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rps23-ps1 Mouse shRNA Plasmid (Locus ID 100038875)
TR518428 1 Kit

Rps23-ps1 Mouse shRNA Plasmid (Locus ID 100038875)

Sign In for Pricing
View Details
Monkey Serine protease 23 (PRSS23) ELISA Kit
EK8095 48 Tests

Monkey Serine protease 23 (PRSS23) ELISA Kit

Sign In for Pricing
View Details
TG003, Clk family kinase inhibitor
TBI1292-5MG 5 mg

TG003, Clk family kinase inhibitor

Sign In for Pricing
View Details
Mouse Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
EKN45534 96 Tests

Mouse Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details
RGD1565033 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6044002 1.0 µg DNA

RGD1565033 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details