Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A8Z054

Expression Region

1-97

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA2 (NM_002488) Human Over-expression Lysate
LY419296 100 µg

NDUFA2 (NM_002488) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL-10 Recombinant Rabbit Monoclonal Antibody [PS00-81] - BSA and Azide free (Detector)
HA721237 100 µL

Human IL-10 Recombinant Rabbit Monoclonal Antibody [PS00-81] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Piperazine Dihydrochloride
TRC-P480100-25G 25 g

Piperazine Dihydrochloride

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), 0.2mg/mL
BNUB1974-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), 0.2mg/mL

Sign In for Pricing
View Details
CF®543-Dextran 10,000 MW, Anionic and Fixable
#80111 1x 1 mg

CF®543-Dextran 10,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
RHOB Human Gene Knockout Kit (CRISPR)
KN209837LP 1 Kit

RHOB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details