Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN)

This Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A9A9I2

Expression Region

1-97

Origin

Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFKHVLMILGVIILTLAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE PPSGEIESLLFALQAAIGAMIIGYFFGYNKAKYDDKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Smegmatis pth Protein (aa 1-191)
VAng-Yyj4775-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Smegmatis pth Protein (aa 1-191)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Acetyl-coenzyme A synthetase (acsA), partial
MBS1428759 Inquire

Recombinant Pseudoalteromonas haloplanktis Acetyl-coenzyme A synthetase (acsA), partial

Sign In for Pricing
View Details
Tmprss11c (NM_001030297) Mouse Tagged ORF Clone Lentiviral Particle
MR215578L4V 200 µL

Tmprss11c (NM_001030297) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMAP1 Rabbit Polyclonal Antibody
orb631312-01 50 µg

SMAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMAP1 Rabbit Polyclonal Antibody
orb631312-02 100 µg

SMAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (HRP)
251500-HRP 100 µL

SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (HRP)

Sign In for Pricing
View Details