Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD)

This Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Anti-sigma-ylaC factor ylaD

UniProt

O07628

Expression Region

1-97

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYL PEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAP2 Rabbit Polyclonal Antibody (BF405)
orb2402897 100 µL

GRAP2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Phospho-MCM2 (Ser40) Rabbit mAb
MBS9467411-01 0.05 mL

Phospho-MCM2 (Ser40) Rabbit mAb

Sign In for Pricing
View Details
Phospho-MCM2 (Ser40) Rabbit mAb
MBS9467411-02 0.1 mL

Phospho-MCM2 (Ser40) Rabbit mAb

Sign In for Pricing
View Details
Phospho-MCM2 (Ser40) Rabbit mAb
MBS9467411-03 5x 0.1 mL

Phospho-MCM2 (Ser40) Rabbit mAb

Sign In for Pricing
View Details
Anti-TNF alpha Antibody Picoband® (APC Conjugate)
A00002-2-APC 100 µg/Vial

Anti-TNF alpha Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
PCDHB10 sgRNA CRISPR Lentivector (Human) (Target 1)
K1606202 1.0 µg DNA

PCDHB10 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details