Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD)

This Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Anti-sigma-ylaC factor ylaD

UniProt

O07628

Expression Region

1-97

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYL PEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAPC3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44507066 1.0 µg DNA

SNAPC3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SH2D4B Rabbit pAb, BF700 conjugated
orb2864634 100 µL

SH2D4B Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
SAT1 Protein Lysate
OCOA00940-20UG 20 µg

SAT1 Protein Lysate

Sign In for Pricing
View Details
CNTFR Protein Vector (Human) (pPB-C-His)
PV010065 500 ng

CNTFR Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
F16
TRC-F118805-250MG 250 mg

F16

Sign In for Pricing
View Details
pCMV-PELO-3×FLAG-Neo Plasmid
PVT57575 2 µg

pCMV-PELO-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details