Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD)

This Recombinant Bacillus subtilis Anti-sigma-ylaC factor ylaD (ylaD) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Anti-sigma-ylaC factor ylaD

UniProt

O07628

Expression Region

1-97

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYL PEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD34 Antibody (HPCA1/4393R) [Alexa Fluor 488]
NBP3-20988AF488 0.1 mL

Rabbit Monoclonal CD34 Antibody (HPCA1/4393R) [Alexa Fluor 488]

Sign In for Pricing
View Details
Notch 1 (mN1A) Alexa Fluor® 647
sc-32745 AF647 200 µg/mL

Notch 1 (mN1A) Alexa Fluor® 647

Sign In for Pricing
View Details
Chloroform 99% For Synthesis
00769 00500 500 mL

Chloroform 99% For Synthesis

Sign In for Pricing
View Details
NDUFS2 Recombinant Rabbit mAb, Cy3 conjugated
orb3183832 100 µL

NDUFS2 Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
Anti-c-Myc, SureLight® R-Phycoerythrin conjugated (Clone 9E10)
AS15 2944 100 µg

Anti-c-Myc, SureLight® R-Phycoerythrin conjugated (Clone 9E10)

Sign In for Pricing
View Details
NUDT16 antibody
70R-18989 50 ul

NUDT16 antibody

Sign In for Pricing
View Details