Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

O26484

Expression Region

1-97

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIHVTYLSGYLAAIISSIIVSAILGLPLTPERPARHSWTPSAIFPTPVIALGLTAISIK LGVTGIYGADLGAVAGVLSAIMTAYFLEDIFPRPEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Noxo1 Plasmid
PVT52655 2 µg

pCMV-SPORT6-Noxo1 Plasmid

Sign In for Pricing
View Details
ZBTB7C (NM_001039360) Human Over-expression Lysate
LC422035 20 µg

ZBTB7C (NM_001039360) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor XII light chain Antibody, AbBy Fluor™ 555 Conjugated
bs-10337R-BF555 100 µL

Factor XII light chain Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PCDHGB3 (NM_032097) Human Tagged ORF Clone Lentiviral Particle
RC221870L3V 200 µL

PCDHGB3 (NM_032097) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ly49s5-set siRNA/shRNA/RNAi Lentivector (Rat)
27800096 4x 500 ng

Ly49s5-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
TMEM230 siRNA (m)
sc-141870 10 µM

TMEM230 siRNA (m)

Sign In for Pricing
View Details