Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

O26484

Expression Region

1-97

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIHVTYLSGYLAAIISSIIVSAILGLPLTPERPARHSWTPSAIFPTPVIALGLTAISIK LGVTGIYGADLGAVAGVLSAIMTAYFLEDIFPRPEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3A Protein Vector (Rat) (pPM-C-HA)
38333026 500 ng

RAB3A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog (FOS) ELISA Kit
YP-W28453-01 48 Tests

Mouse V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog (FOS) ELISA Kit

Sign In for Pricing
View Details
Mouse V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog (FOS) ELISA Kit
YP-W28453-02 96 Tests

Mouse V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog (FOS) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human Vimentin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4) (Western Blot,IHC-p,ELISA) 200UL
IRBAMLVIMAP72200UL 200 µL

Rabbit Anti Human Vimentin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4) (Western Blot,IHC-p,ELISA) 200UL

Sign In for Pricing
View Details
Antitumor agent-188
HY-169292 1 Each

Antitumor agent-188

Sign In for Pricing
View Details
BrIR2
T85916-01 10 mg

BrIR2

Sign In for Pricing
View Details