Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

O70632

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/156/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Arsanilic Acid
TRC-A774100-1G 1 g

2-Arsanilic Acid

Sign In for Pricing
View Details
KRBA2 (NM_213597) Human Over-expression Lysate
LC403912 20 µg

KRBA2 (NM_213597) Human Over-expression Lysate

Sign In for Pricing
View Details
(±)-Oxychlordane
TRC-O870575-1MG 1 mg

(±)-Oxychlordane

Sign In for Pricing
View Details
Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein
TP320460 20 µg

Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF640R conjugate, 0.1mg/mL
BNC402818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HMGN2P46 (NM_001005269) Human Over-expression Lysate
LC423828 20 µg

HMGN2P46 (NM_001005269) Human Over-expression Lysate

Sign In for Pricing
View Details