Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

O70632

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/156/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (T200/797), CF488A conjugate, 0.1mg/mL
BNC880797-100 1x 100 µL

CD45RO (T200/797), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Water Chiller BCHI-412
BCHI-412 Each

Water Chiller BCHI-412

Sign In for Pricing
View Details
N-Nitroso Isavuconazonium Sulfate
TRC-N137473-5MG 5 mg

N-Nitroso Isavuconazonium Sulfate

Sign In for Pricing
View Details
11-Dehydro-6Alpha,17-dihydroxy-corticosterone 21-Acetate
TRC-D230313-25MG 25 mg

11-Dehydro-6Alpha,17-dihydroxy-corticosterone 21-Acetate

Sign In for Pricing
View Details
RPL14 Human Gene Knockout Kit (CRISPR)
KN400425 1 Kit

RPL14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANXA2R (NM_001014279) Human Over-expression Lysate
LC423048 20 µg

ANXA2R (NM_001014279) Human Over-expression Lysate

Sign In for Pricing
View Details