Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

O70632

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/156/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HC-030031
SIH-303-50MG 50 mg

HC-030031

Sign In for Pricing
View Details
Anti-CD278 (7E.17G9) In Vivo Antibody - Low Endotoxin
ICH1082-5mg 5 mg

Anti-CD278 (7E.17G9) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
ZNF93 Human qPCR Primer Pair (NM_031218)
HP230855 200 Reactions

ZNF93 Human qPCR Primer Pair (NM_031218)

Sign In for Pricing
View Details
1'-[(tert-Butoxy)carbonyl]-3H-spiro[1-benzofuran-2,4'-piperidine]-5-carboxylic Acid
TRC-T112535-250MG 250 mg

1'-[(tert-Butoxy)carbonyl]-3H-spiro[1-benzofuran-2,4'-piperidine]-5-carboxylic Acid

Sign In for Pricing
View Details
ZNRF2-Specific antibody
FNab09746 100 µg

ZNRF2-Specific antibody

Sign In for Pricing
View Details
Arhgap27 Mouse Gene Knockout Kit (CRISPR)
KN501501 1 Kit

Arhgap27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details