Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A2E4

Expression Region

1-97

Origin

Influenza A virus (strain A/Turkey/Ontario/7732/1966 H5N9)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILCILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aminopeptidase A (ENPEP) activation kit by CRISPRa
GA101409 1 Kit

Human Aminopeptidase A (ENPEP) activation kit by CRISPRa

Sign In for Pricing
View Details
BSDC1 Antibody
KC-42518-01 50 μL

BSDC1 Antibody

Sign In for Pricing
View Details
BSDC1 Antibody
KC-42518-02 100 µL

BSDC1 Antibody

Sign In for Pricing
View Details
BSDC1 Antibody
KC-42518-03 1 mL

BSDC1 Antibody

Sign In for Pricing
View Details
GCET1 (SERPINA9) (NM_001284276) Human Tagged ORF Clone
RG237190 10 µg

GCET1 (SERPINA9) (NM_001284276) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: sigmoid
CP618174 150 µg

Tissue Protein Lysate, Colon: sigmoid

Sign In for Pricing
View Details