Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A2H5

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Scotland/1959 H5N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDCLFFKCIYRRLKYGLK GGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfaisodimidine 100mg
A17581-100 100 mg

Sulfaisodimidine 100mg

Sign In for Pricing
View Details
Rabbit Polyclonal KLRA1 Antibody [DyLight 650]
NBP1-77343C 0.1 mL

Rabbit Polyclonal KLRA1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Elaiophylin
sc-202147A 5 mg

Elaiophylin

Sign In for Pricing
View Details
Cpeb4 ORF Vector (Rat) (pORF)
16748016 1.0 µg DNA

Cpeb4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Alpha (TNFa) CLIA Kit
MBS2708710-01 24 Strip Well

Human Tumor Necrosis Factor Alpha (TNFa) CLIA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Alpha (TNFa) CLIA Kit
MBS2708710-02 48 Well

Human Tumor Necrosis Factor Alpha (TNFa) CLIA Kit

Sign In for Pricing
View Details