Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A2H5

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Scotland/1959 H5N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDCLFFKCIYRRLKYGLK GGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR105 (P2RY14) (NM_014879) Human Untagged Clone
SC114730 10 µg

GPR105 (P2RY14) (NM_014879) Human Untagged Clone

Sign In for Pricing
View Details
H-Gly-Gly-Ala-OH
4001910.0001 1 g

H-Gly-Gly-Ala-OH

Sign In for Pricing
View Details
Recombinant Replication protein E1 (E1), partial
MBS1477433 Inquire

Recombinant Replication protein E1 (E1), partial

Sign In for Pricing
View Details
NOTCH4 (NM_004557) Human Tagged ORF Clone Lentiviral Particle
RC221762L1V 200 µL

NOTCH4 (NM_004557) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ENPP6, ID (ENPP6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 soluble form) (MaxLight 750)
MBS6295719-01 0.1 mL

ENPP6, ID (ENPP6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 soluble form) (MaxLight 750)

Sign In for Pricing
View Details
ENPP6, ID (ENPP6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 soluble form) (MaxLight 750)
MBS6295719-02 5x 0.1 mL

ENPP6, ID (ENPP6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6, Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 soluble form) (MaxLight 750)

Sign In for Pricing
View Details