Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A2I6

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Pennsylvania/1/1983 H5N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWECKCSDSSDPLIIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGAPESMREEYRQEQQSAVDVDDVHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd13a (BC108413) Mouse Tagged Lenti ORF Clone
MR209181L4 10 µg

Ankrd13a (BC108413) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PSMD6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9367R-BF647 100 µL

PSMD6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Fam183b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
19864114 3x 1.0 µg

Fam183b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RN216 rabbit pAb
UB-GEN-9449 100 µL

RN216 rabbit pAb

Sign In for Pricing
View Details
N- (12-Cyanindolizino[2,3-b]quinoxalin-2-yl) -2-thiophenecarboxamide
165078 10 mg

N- (12-Cyanindolizino[2,3-b]quinoxalin-2-yl) -2-thiophenecarboxamide

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb1315 Protein (aa 1-163)
VAng-Yyj3008-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Bovis Mb1315 Protein (aa 1-163)

Sign In for Pricing
View Details