Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A2I6

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Pennsylvania/1/1983 H5N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWECKCSDSSDPLIIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGAPESMREEYRQEQQSAVDVDDVHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMT1 Antibody - middle region : Biotin (ARP48668_T100-Biotin)
ARP48668_T100-Biotin 100 µL

PCMT1 Antibody - middle region : Biotin (ARP48668_T100-Biotin)

Sign In for Pricing
View Details
EVL Human Recombinant Protein
TP724956 50 µg

EVL Human Recombinant Protein

Sign In for Pricing
View Details
Anti-SLAMF7/CD319 Antibody, Mouse Monoclonal
MBS8119024-01 0.1 mL

Anti-SLAMF7/CD319 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-SLAMF7/CD319 Antibody, Mouse Monoclonal
MBS8119024-02 5x 0.1 mL

Anti-SLAMF7/CD319 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
TrxR2 (F-5) Alexa Fluor® 680
sc-376868 AF680 200 µg/mL

TrxR2 (F-5) Alexa Fluor® 680

Sign In for Pricing
View Details
OR4A43P-set siRNA/shRNA/RNAi Lentivector (Human)
35159091 4x 500 ng

OR4A43P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details