Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A447

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Germany/1949 H10N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit
MBS9919928-01 48 Well

Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit

Sign In for Pricing
View Details
Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit
MBS9919928-02 96 Well

Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit

Sign In for Pricing
View Details
Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit
MBS9919928-03 5x 96 Well

Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit

Sign In for Pricing
View Details
Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit
MBS9919928-04 10x 96 Well

Porcine Pyrroline-5-Carboxylate Reductase-Like (PYCRL) ELISA Kit

Sign In for Pricing
View Details
C17orf87 AAV Vector (Human) (CMV)
14012101 1 µg

C17orf87 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GJB6 Protein Vector (Rat) (pPB-N-His)
PV270283 500 ng

GJB6 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details