Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A447

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Germany/1949 H10N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-27B Antibody
E38PA3906 100 µL

IL-27B Antibody

Sign In for Pricing
View Details
[KO Validated] DPYSL2 Polyclonal Antibody
28625-01 50 µL

[KO Validated] DPYSL2 Polyclonal Antibody

Sign In for Pricing
View Details
[KO Validated] DPYSL2 Polyclonal Antibody
28625-02 100 µL

[KO Validated] DPYSL2 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ANKDD1A shRNA (UAS) - Lentiviral human ANKDD1A shRNA (UAS, RFP) (100)
GTR15313971 1 Vial

Lentiviral human ANKDD1A shRNA (UAS) - Lentiviral human ANKDD1A shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human POMGNT1 Protein
CRP2129-01 10 µg

Recombinant Human POMGNT1 Protein

Sign In for Pricing
View Details
Recombinant Human POMGNT1 Protein
CRP2129-02 50 µg

Recombinant Human POMGNT1 Protein

Sign In for Pricing
View Details