Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A447

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Germany/1949 H10N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MonoMethyl-Histone H2B type 2E (Arg80) Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62302R-BF488 100 µL

MonoMethyl-Histone H2B type 2E (Arg80) Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
ANPEP Antibody - N-terminal region : HRP (ARP61079_P050-HRP)
ARP61079_P050-HRP 100 µL

ANPEP Antibody - N-terminal region : HRP (ARP61079_P050-HRP)

Sign In for Pricing
View Details
Glycolithocholic acid
C8620-5 5 mg

Glycolithocholic acid

Sign In for Pricing
View Details
PKP2 Rabbit Polyclonal Antibody (PE)
orb2584400 100 µg

PKP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
HnRNP A1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61490R-BF555-01 20 µL

HnRNP A1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
HnRNP A1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61490R-BF555-02 100 µL

HnRNP A1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details